Glycosyltransferase 8 Domain Containing 2 (GLT8D2) (C-Term) antibody

Details for Product No. ABIN503114
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 1110021D20Rik, RGD1560432, si:dkey-22l11.1, zgc:136873
Epitope
C-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(14), (13), (12), (12), (12)
Host
Rabbit
(16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (4), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN503114
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GLT8D2
Sequence IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHND LWESWFVPDP
Predicted Reactivity Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Dog : 90 %, Pig : 90 %, Guinea pig : 70 %
Characteristics This is a rabbit polyclonal antibody against GLT8D2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GLT8D2
Background GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown
Molecular Weight 40 kDa
Gene ID 83468
NCBI Accession NM_031302, NP_112592
UniProt Q9H1C3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 349 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (16)
Reactivities (14), (13), (12), (12), (12)
Applications (10), (7), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
back to top