Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503114

Glycosyltransferase 8 Domain Containing 2 (GLT8D2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110021D20Rik, RGD1560432, si:dkey-22l11.1, zgc:136873
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503114
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GLT8D2 antibody: synthetic peptide directed towards the C terminal of human GLT8D2
Sequence IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHND LWESWFVPDP
Predicted Reactivity Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Dog : 92%, Pig : 92%, Guinea pig : 76%
Characteristics This is a rabbit polyclonal antibody against GLT8D2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GLT8D2
Background GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown
Molecular Weight 40kDa
Gene ID 83468
NCBI Accession NP_112592, NM_031302
UniProt Q9H1C3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GLT8D2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Glycosyltransferase 8 Domain Containing 2 (GLT8D2)", type "Antibodies"
Hosts (15)
Reactivities (14), (12), (12), (12), (12)
Applications (10), (6), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon