Did you know that you can buy products from over 140 different suppliers from us?

Enkurin Domain Containing 1 (ENKD1) (C-Term) antibody

Details for Product No. ABIN503225
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C16orf48, DAKV6410, C18H16orf48, AI606951, E130303B06Rik
Epitope
C-Term
(2), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Human
(6)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503225
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human C16orf48
Sequence DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQ SQSQLLRELV
Predicted Reactivity Human :100 %,   Rat :90 %,   Dog :80 %,   Bovine :80 %,   Mouse :80 %,  
Characteristics This is a rabbit polyclonal antibody against C16orf48. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C16orf48
Background The exact function of C16orf48 remains unknown.
Molecular Weight 39 kDa
Gene ID 84080
NCBI Accession NM_032140, NP_115516
UniProt Q9H0I2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 346 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Enkurin Domain Containing 1 (ENKD1) (C-Term) antibody WB Suggested Anti-C16orf48 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human brain
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (8), (1)
Reactivities (6)
Applications (9), (1)
Epitopes (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503225
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top