Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503225

Enkurin Domain Containing 1 (ENKD1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C16orf48, DAKV6410, C18H16orf48, AI606951, E130303B06Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503225
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C16orf48 antibody: synthetic peptide directed towards the C terminal of human C16orf48
Sequence DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQ SQSQLLRELV
Predicted Reactivity Human :100%,   Rat :91%,   Dog :85%,   Bovine :85%,   Mouse :83%,  
Characteristics This is a rabbit polyclonal antibody against C16orf48. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C16orf48
Background The exact function of C16orf48 remains unknown.
Molecular Weight 39kDa
Gene ID 84080
NCBI Accession NP_115516, NM_032140
UniProt Q9H0I2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C16orf48 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Enkurin Domain Containing 1 (ENKD1)", type "Antibodies"
Hosts (8)
Reactivities (5)
Applications (8), (3)
Epitopes (2), (2), (1)
Beacon