Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503241

AT Rich Interactive Domain 5A (MRF1-Like) (ARID5A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MRF1, MRF-1, RP11-363D14, D430024K22Rik, Mrf1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503241
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARID5A antibody: synthetic peptide directed towards the N terminal of human ARID5A
Sequence MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLE DSPEAGGERE
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ARID5A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ARID5A
Background Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth. Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]).
Molecular Weight 64kDa
Gene ID 10865
NCBI Accession NP_997646, NM_212481
UniProt Q03989
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARID5A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "AT Rich Interactive Domain 5A (MRF1-Like) (ARID5A)", type "Antibodies"
Hosts (11), (1)
Reactivities (12), (3), (3), (3), (2), (2), (2)
Applications (12), (2), (1), (1), (1)
Epitopes (4), (2), (2), (1), (1)
Beacon