Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503415

HORMA Domain Containing 2 (HORMAD2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930529M09Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503415
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HORMAD2 antibody: synthetic peptide directed towards the middle region of human HORMAD2
Sequence YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFES GTNNEDIKKA
Predicted Reactivity Dog : 92%, Guinea pig : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against HORMAD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HORMAD2
Background The specific function of the protein remains unknown.
Molecular Weight 35kDa
Gene ID 150280
NCBI Accession NP_689723, NM_152510
UniProt Q8N7B1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HORMAD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "HORMA Domain Containing 2 (HORMAD2)", type "Antibodies"
Hosts (18), (1)
Reactivities (17), (14), (14), (13), (13), (12), (1)
Applications (10), (10), (4), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon