Did you know that you can buy products from over 140 different suppliers from us?

HORMA Domain Containing 2 (HORMAD2) (Middle Region) antibody

Details for Product No. ABIN503415
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930529M09Rik
Epitope
Middle Region
(2), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Cow (Bovine), Human
(19), (14), (14), (13), (13), (12), (1)
Host
Rabbit
(20), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (10), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503415
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HORMAD2
Sequence YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFES GTNNEDIKKA
Predicted Reactivity Dog : 92 %, Guinea pig : 92 %, Pig : 92 %
Characteristics This is a rabbit polyclonal antibody against HORMAD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HORMAD2
Background The specific function of the protein remains unknown.
Molecular Weight 35 kDa
Gene ID 150280
NCBI Accession NM_152510, NP_689723
UniProt Q8N7B1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 307 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-HORMA Domain Containing 2 (HORMAD2) (Middle Region) antibody WB Suggested Anti-HORMAD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Validation Images
back to top