Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503424

Mixed Lineage Kinase Domain-Like (MLKL) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9130019I15Rik, MLKL
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503424
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MLKL antibody: synthetic peptide directed towards the N terminal of human MLKL
Sequence DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRR AFQMLRRDNE
Predicted Reactivity Human : 100%, Horse : 90%, Rat : 90%, Bovine : 84%, Pig : 83%
Characteristics This is a rabbit polyclonal antibody against MLKL. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MLKL
Background The specific function of this protein remains unknown.
Molecular Weight 54kDa
Gene ID 197259
NCBI Accession NP_689862, NM_152649
UniProt Q8NB16
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MLKL antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Mixed Lineage Kinase Domain-Like (MLKL)", type "Antibodies"
Hosts (9), (6)
Reactivities (11), (3)
Applications (14), (7), (3), (3), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1)
Beacon