Mixed Lineage Kinase Domain-Like (MLKL) (N-Term) antibody

Details for Product No. ABIN503424
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 9130019I15Rik, MLKL
Epitope
N-Term
(2), (2), (2), (1), (1), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Human
(10), (3), (1)
Host
Rabbit
(8), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (6), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503424
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MLKL
Sequence DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRR AFQMLRRDNE
Predicted Reactivity Human : 100 %, Horse : 90 %, Rat : 90 %, Bovine : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against MLKL. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MLKL
Background The specific function of this protein remains unknown.
Molecular Weight 54 kDa
Gene ID 197259
NCBI Accession NM_152649, NP_689862
UniProt Q8NB16
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 471 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mixed Lineage Kinase Domain-Like (MLKL) (N-Term) antibody WB Suggested Anti-MLKL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (8), (5)
Reactivities (10), (3), (1)
Applications (12), (6), (3), (2), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1)
back to top