Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503448

Chromosome 12 Open Reading Frame 53 (C12orf53) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C12orf53, PANP, leda-1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503448
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C12orf53 antibody: synthetic peptide directed towards the middle region of human C12orf53
Sequence VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSD SMRGDGDGLI
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against C12orf53. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C12orf53
Background The specific function of the protein remains unknown.
Molecular Weight 30kDa
Gene ID 196500
NCBI Accession NP_710152, NM_153685
UniProt Q8IYJ0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C12orf53 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Chromosome 12 Open Reading Frame 53 (C12orf53)", type "Antibodies"
Hosts (22)
Reactivities (21), (20), (17), (17), (17), (17)
Applications (18), (10), (8), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1)
Beacon