Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503449

Family with Sequence Similarity 154, Member A (FAM154A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C9orf138, 4930500O09Rik, Fam154a
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503449
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C9orf138 antibody: synthetic peptide directed towards the N terminal of human C9orf138
Sequence SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRR DFGPHKVAPV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C9orf138. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C9orf138
Background The specific function of the protein remains unknown.
Molecular Weight 54kDa
Gene ID 158297
NCBI Accession NP_714918, NM_153707
UniProt Q8IYX7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C9orf138 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 154, Member A (FAM154A)", type "Antibodies"
Hosts (13)
Reactivities (12), (11), (11), (11), (11)
Applications (9), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon