Did you know that you can buy products from over 140 different suppliers from us?

Family with Sequence Similarity 154, Member A (FAM154A) (N-Term) antibody

Details for Product No. ABIN503449
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C9orf138, 4930500O09Rik, Fam154a
Epitope
N-Term
(1)
Reactivity
Human
(13), (11), (11), (11), (11)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (5), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503449
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C9orf138
Sequence SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRR DFGPHKVAPV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against C9orf138. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C9orf138
Background The specific function of the protein remains unknown.
Molecular Weight 54 kDa
Gene ID 158297
NCBI Accession NM_153707, NP_714918
UniProt Q8IYX7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 474 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 154, Member A (FAM154A) (N-Term) antibody WB Suggested Anti-C9orf138 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Hosts (13), (1)
Reactivities (13), (11), (11), (11), (11)
Applications (9), (5), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503449
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top