Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger, SWIM-Type Containing 3 (ZSWIM3) (N-Term) antibody

Details for Product No. ABIN503483
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C20orf164, C86566, 4921517A06Rik
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(13), (12), (12), (12), (12), (12), (12)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503483
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZSWIM3
Sequence SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREAD MCPAYLLLRY
Predicted Reactivity Horse : 100 %, Pig : 100 %, Dog : 90 %, Rabbit : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against ZSWIM3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZSWIM3
Background The specific function of this protein remains unknown.
Molecular Weight 77 kDa
Gene ID 140831
NCBI Accession NM_080752, NP_542790
UniProt Q96MP5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 696 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger, SWIM-Type Containing 3 (ZSWIM3) (N-Term) antibody WB Suggested Anti-ZSWIM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: DU145 cell lysate
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503483
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top