Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503483

Zinc Finger, SWIM-Type Containing 3 (ZSWIM3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C20orf164, C86566, 4921517A06Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503483
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZSWIM3 antibody: synthetic peptide directed towards the N terminal of human ZSWIM3
Sequence SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREAD MCPAYLLLRY
Predicted Reactivity Horse : 100%, Pig : 100%, Dog : 92%, Rabbit : 92%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against ZSWIM3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZSWIM3
Background The specific function of this protein remains unknown.
Molecular Weight 77kDa
Gene ID 140831
NCBI Accession NP_542790, NM_080752
UniProt Q96MP5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZSWIM3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "Zinc Finger, SWIM-Type Containing 3 (ZSWIM3)", type "Antibodies"
Hosts (14)
Reactivities (13), (12), (12), (12), (12), (12), (12)
Applications (10), (5), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon