Did you know that you can buy products from over 140 different suppliers from us?

FLJ33790 (N-Term) antibody

Details for Product No. ABIN503530
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
Rabbit
Clonality
Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503530
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FLJ33790
Sequence RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWT PLPSLPGYTR
Predicted Reactivity Rat :100 %,   Human :100 %,   Mouse :100 %,   Bovine :80 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ33790. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The specific functin of this protein remains unknown.
Molecular Weight 40 kDa
Gene ID 283212
NCBI Accession NM_001039548, NP_001034637
UniProt Q6PF15
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 363 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ33790 (N-Term) antibody WB Suggested Anti-FLJ33790 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503530
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top