Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503530

FLJ33790 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
Rabbit
Clonality Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503530
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ33790 antibody: synthetic peptide directed towards the N terminal of human FLJ33790
Sequence RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWT PLPSLPGYTR
Predicted Reactivity Rat :100%,   Human :100%,   Mouse :100%,   Bovine :85%,   Dog :85%,  
Characteristics This is a rabbit polyclonal antibody against FLJ33790. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background The specific functin of this protein remains unknown.
Molecular Weight 40kDa
Gene ID 283212
NCBI Accession NP_001034637, NM_001039548
UniProt Q6PF15
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ33790 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Beacon