Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503570

LIM and SH3 Protein 1 (LASP1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MLN50, Lasp-1, Def-4, SH3P6, AA408629, Tg(Col1a1-lacZ)1Ngma, fb92f05, zgc:77542, wu:fb92f05, LASP1, DKFZp459O1227, lasp1, MGC53336, MGC89667, mln50, lasp-1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503570
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LASP1 antibody: synthetic peptide directed towards the middle region of human LASP1
Sequence IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDG SSYRRPLEQQ
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against LASP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LASP1
Background LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.This gene encodes a member of a LIM protein subfamily which is characterized by a LIM motif and a domain of Src homology region 3. This protein functions as an actin-binding protein and possibly in cytoskeletal organization.
Molecular Weight 30kDa
Gene ID 3927
NCBI Accession NP_006139, NM_006148
UniProt Q14847
Research Area Signaling, Cytoskeleton, Microfilaments
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LASP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Stone, Merriman, Cantor et al.: "High density SNP association study of a major autism linkage region on chromosome 17." in: Human molecular genetics, Vol. 16, Issue 6, pp. 704-15, 2007 (PubMed).

Alternatives for antigen "LIM and SH3 Protein 1 (LASP1)", type "Antibodies"
Hosts (16), (15), (4)
Reactivities (27), (7), (6), (6), (4), (1), (1), (1), (1), (1)
Applications (32), (18), (5), (1), (1), (1)
Epitopes (8), (6), (3), (2), (2), (2), (1), (1)
Beacon