Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503584

MTO1 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310039H01Rik, 5730419A02Rik, COXPD10
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503584
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTO1 antibody: synthetic peptide directed towards the N terminal of human MTO1
Sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGL AQTLEKLGFV
Predicted Reactivity Chicken : 100%, Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against MTO1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 81kDa
Gene ID 25821
NCBI Accession NP_001116698, NM_001123226
UniProt Q9Y2Z2
Research Area Chromatin and Nuclear Signaling, DNA/RNA, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTO1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Krull, Brosius, Schmitz: "Alu-SINE exonization: en route to protein-coding function." in: Molecular biology and evolution, Vol. 22, Issue 8, pp. 1702-11, 2005 (PubMed).

Alternatives for antigen "MTO1", type "Antibodies"
Hosts (10)
Reactivities (10), (2), (2)
Applications (10), (9), (5), (1), (1)
Epitopes (3), (1)
Beacon