Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503601

WW Domain Binding Protein 2 (WBP2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms WBP-2, zgc:64061, wu:fc64g04, MGC68743, wbp-2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503601
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WBP2 antibody: synthetic peptide directed towards the N terminal of human WBP2
Sequence MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPF YLMKDCEIKQ
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against WBP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WBP2
Background The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding
Molecular Weight 28kDa
Gene ID 23558
NCBI Accession NP_036610, NM_012478
UniProt Q969T9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WBP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dhananjayan, Ramamoorthy, Khan et al.: "WW domain binding protein-2, an E6-associated protein interacting protein, acts as a coactivator of estrogen and progesterone receptors." in: Molecular endocrinology (Baltimore, Md.), Vol. 20, Issue 10, pp. 2343-54, 2006 (PubMed).

Alternatives for antigen "WW Domain Binding Protein 2 (WBP2)", type "Antibodies"
Hosts (22), (2)
Reactivities (23), (12), (12)
Applications (15), (10), (7), (5), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (2), (2), (2)
Beacon