Did you know that you can buy products from over 140 different suppliers from us?

Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2) (Middle Region) antibody

Details for Product No. ABIN503605
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P5CR2, 1810018M05Rik, P5cr2, p5c, p5cr, pro3, pycr, pig45, pp222, pycr2, arcl2b
Epitope
Middle Region
(8), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human
(34), (1), (1), (1), (1), (1)
Host
Rabbit
(20), (16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB), Immunoprecipitation (IP)
(36), (14), (12), (9), (7), (5), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503605
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PYCR2
Sequence LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINA VEASCIRTRE
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %
Characteristics This is a rabbit polyclonal antibody against PYCR2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PYCR2
Background PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.
Molecular Weight 34 kDa
Gene ID 29920
NCBI Accession NM_013328, NP_037460
UniProt Q96C36
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 320 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2) (Middle Region) antibody WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
anti-Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2) (Middle Region) antibody (2) anti-Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2) (Middle Region) antibody (Image 2)
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503605
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top