Tropomodulin 2 (TMOD2) (N-Term) antibody

Details for Product No. ABIN503645
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NTMOD, N-Tmod, zgc:86648, N-TMOD
Epitope
N-Term
(5), (3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
(17), (6), (4), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(15), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (5), (3), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503645
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMOD2
Sequence LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEK EALEQKDRED
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against TMOD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMOD2
Background TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.
Molecular Weight 39 kDa
Gene ID 29767
NCBI Accession NM_014548, NP_055363
UniProt Q9NZR1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 351 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tropomodulin 2 (TMOD2) (N-Term) antibody WB Suggested Anti-TMOD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Background publications Pawlak, McGarvey, Nguyen et al.: "Alterations in tropomyosin isoform expression in human transitional cell carcinoma of the urinary bladder." in: International journal of cancer. Journal international du cancer, Vol. 110, Issue 3, pp. 368-73, 2004 (PubMed).

Hosts (15), (4)
Reactivities (17), (6), (4), (1), (1), (1), (1), (1), (1)
Applications (18), (5), (3), (3), (2), (1)
Epitopes (5), (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top