Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503645

Tropomodulin 2 (TMOD2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NTMOD, N-Tmod, zgc:86648, N-TMOD
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503645
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMOD2 antibody: synthetic peptide directed towards the N terminal of human TMOD2
Sequence LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEK EALEQKDRED
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against TMOD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMOD2
Background TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.
Molecular Weight 39kDa
Gene ID 29767
NCBI Accession NP_055363, NM_014548
UniProt Q9NZR1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMOD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pawlak, McGarvey, Nguyen et al.: "Alterations in tropomyosin isoform expression in human transitional cell carcinoma of the urinary bladder." in: International journal of cancer. Journal international du cancer, Vol. 110, Issue 3, pp. 368-73, 2004 (PubMed).

Alternatives for antigen "Tropomodulin 2 (TMOD2)", type "Antibodies"
Hosts (14), (5)
Reactivities (17), (6), (5), (1), (1), (1), (1), (1), (1)
Applications (19), (5), (3), (3), (1), (1), (1)
Epitopes (6), (5), (2), (1)
Beacon