Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503667

Deleted in Primary Ciliary Dyskinesia Homolog (Mouse) (DPCD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ndac, 5330431N19Rik, RGD1307648, RP11-529I10.4, rp11-529i10.4, zgc:153412
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503667
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RP11-529I10.4 antibody: synthetic peptide directed towards the N terminal of human RP11-529I10.4
Sequence MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLG AGNLGPELIK
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against RP11-529I10.4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RP11-529I10.4
Background RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).
Molecular Weight 23kDa
Gene ID 25911
NCBI Accession NP_056263, NM_015448
UniProt Q9BVM2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RP11-529I10.4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Deleted in Primary Ciliary Dyskinesia Homolog (Mouse) (DPCD)", type "Antibodies"
Hosts (10), (1)
Reactivities (9), (5), (1), (1), (1), (1), (1), (1)
Applications (11), (2), (1), (1)
Epitopes (2), (2), (2), (2), (1), (1), (1)
Beacon