Chromosome 3 Open Reading Frame 62 (C3orf62) (Middle Region) antibody

Details for Product No. ABIN503793
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(13), (12), (12), (12), (12), (12)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3), (3)
Pubmed 2 references available
Catalog no. ABIN503793
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C3orf62
Sequence IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWA LLMDKSPQKA
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against C3orf62. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C3orf62
Background The specific function of the protein remains unknown.
Molecular Weight 30 kDa
Gene ID 375341
NCBI Accession NM_198562, NP_940964
UniProt Q6ZUJ4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 267 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 3 Open Reading Frame 62 (C3orf62) (Middle Region) antibody WB Suggested Anti-C3orf62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (14)
Reactivities (13), (12), (12), (12), (12), (12)
Applications (10), (5), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top