Transmembrane Protein 110 (TMEM110) (N-Term) antibody

Details for Product No. ABIN503794
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AW554125, 1810038N08Rik, 2310014H19Rik, MGC69149, zgc:63630, MGC88939, MGC142756
Epitope
N-Term
(3), (1)
Reactivity
Human
(4), (3)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6)
Pubmed 2 references available
Catalog no. ABIN503794
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM110
Sequence MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFL QGLLGVVAFS
Predicted Reactivity Human : 100 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against TMEM110. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM110
Background The function of this protein remains unknown.
Molecular Weight 33 kDa
Gene ID 375346
NCBI Accession NM_198563, NP_940965
UniProt Q86TL2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 294 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Protein 110 (TMEM110) (N-Term) antibody WB Suggested Anti-TMEM110 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (6)
Reactivities (4), (3)
Applications (6)
Epitopes (3), (1)
back to top