Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503807

Zinc Finger, C3HC-Type Containing 13 (ZCCHC13) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CNBP2, ZNF9L
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503807
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZCCHC13 antibody: synthetic peptide directed towards the middle region of human ZCCHC13
Sequence GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLR QIPTSSQGMS
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZCCHC13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZCCHC13
Background The specific function of this protein remains unknown.
Molecular Weight 18kDa
Gene ID 389874
NCBI Accession NP_976048, NM_203303
UniProt Q8WW36
Research Area Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZCCHC13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "Zinc Finger, C3HC-Type Containing 13 (ZCCHC13)", type "Antibodies"
Hosts (3), (1)
Reactivities (3)
Applications (4), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon