Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein S15 (RPS15) (Middle Region) antibody

Details for Product No. ABIN503870
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RIG, S15, rig, wu:fa93f04, wu:fa99b07, zgc:103714, zgc:92743
Epitope
Middle Region
(9), (6), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Caenorhabditis elegans (C. elegans), Human, Chicken
(27), (10), (10), (1), (1)
Host
Rabbit
(26), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (19), (11), (4), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503870
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RPS15
Sequence GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIG ATHSSRFIPL
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Mouse : 100 %, Rabbit : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against RPS15. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RPS15
Background The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19P family of ribosomal proteins. It is located in the cytoplasm. This gene has been found to be activated in various tumors, such as insulinomas, esophageal cancers, and colon cancers. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 17 kDa
Gene ID 6209
NCBI Accession NM_001018, NP_001009
UniProt P62841
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 145 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein S15 (RPS15) (Middle Region) antibody WB Suggested Anti-RPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
Background publications Yu, Ji, Doudna et al.: "Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes." in: Protein science : a publication of the Protein Society, Vol. 14, Issue 6, pp. 1438-46, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503870
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top