Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503870

Ribosomal Protein S15 (RPS15) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RIG, S15, rig, wu:fa93f04, wu:fa99b07, zgc:103714, zgc:92743
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Caenorhabditis elegans (C. elegans), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503870
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPS15 antibody: synthetic peptide directed towards the middle region of human RPS15
Sequence GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIG ATHSSRFIPL
Predicted Reactivity Chicken : 100%, Dog : 100%, Mouse : 100%, Rabbit : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against RPS15. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RPS15
Background The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19P family of ribosomal proteins. It is located in the cytoplasm. This gene has been found to be activated in various tumors, such as insulinomas, esophageal cancers, and colon cancers. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 17kDa
Gene ID 6209
NCBI Accession NP_001009, NM_001018
UniProt P62841
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPS15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yu, Ji, Doudna et al.: "Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes." in: Protein science : a publication of the Protein Society, Vol. 14, Issue 6, pp. 1438-46, 2005 (PubMed).

Alternatives for antigen "Ribosomal Protein S15 (RPS15)", type "Antibodies"
Hosts (16), (4)
Reactivities (17), (7), (7), (1), (1)
Applications (17), (11), (5), (3), (3), (3), (1)
Epitopes (4), (4), (3), (2), (1)
Beacon