Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503889

Ribosomal Protein S15a (RA) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms S15a, A630031B11Rik, wu:fb04b07
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503889
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPS15A antibody: synthetic peptide directed towards the middle region of human RPS15A
Sequence KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGI MDHEEARRKH
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Zebrafish : 100%, Goat : 92%
Characteristics This is a rabbit polyclonal antibody against RPS15A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RPS15A
Background The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 15kDa
Gene ID 6210
NCBI Accession NP_001025180, NM_001030009
UniProt P62244
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPS15A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yu, Ji, Doudna et al.: "Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes." in: Protein science : a publication of the Protein Society, Vol. 14, Issue 6, pp. 1438-46, 2005 (PubMed).

Alternatives for antigen "Ribosomal Protein S15a (RA)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5), (3), (3), (1)
Epitopes (3), (2), (1), (1)
Beacon