Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein S15a (RA) (Middle Region) antibody

Details for Product No. ABIN503889
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fb04b07, S15a, A630031B11Rik
Epitope
Middle Region
(7), (6), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Dog (Canine), Human
(8)
Host
Rabbit
(9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (7), (6), (6), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503889
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RPS15A
Sequence KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGI MDHEEARRKH
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Zebrafish : 100 %, Goat : 90 %
Characteristics This is a rabbit polyclonal antibody against RPS15A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RPS15A
Background The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 15 kDa
Gene ID 6210
NCBI Accession NM_001030009, NP_001025180
UniProt P62244
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 130 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein S15a (RA) (Middle Region) antibody WB Suggested Anti-RPS15A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle
Background publications Yu, Ji, Doudna et al.: "Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes." in: Protein science : a publication of the Protein Society, Vol. 14, Issue 6, pp. 1438-46, 2005 (PubMed).

Validation Images
back to top