Chromosome 18 Open Reading Frame 32 (C18orf32) (Middle Region) antibody

Details for Product No. ABIN503896
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(1)
Reactivity
Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Catalog no. ABIN503896
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C18orf32
Sequence PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTK GPTEICDKKK
Predicted Reactivity Sumatran orangutan :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against C18orf32. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C18orf32
Background The function of this protein remains unknown.
Molecular Weight 9 kDa
Gene ID 497661
NCBI Accession NM_001035005, NP_001030177
UniProt Q8TCD1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 76 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 18 Open Reading Frame 32 (C18orf32) (Middle Region) antibody WB Suggested Anti-C18orf32 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top