Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503903

Acyl-CoA Binding Domain Containing 7 (ACBD7) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9230116B18Rik, RGD1564164, bA455B2.2, zgc:114176
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503903
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ACBD7 antibody: synthetic peptide directed towards the N terminal of human ACBD7
Sequence MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGD INIACPGMLD
Predicted Reactivity Human : 100%, Bovine : 85%, Horse : 85%, Guinea pig : 84%, Rabbit : 84%, Mouse : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against ACBD7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ACBD7
Background The function of this protein remains unknown.
Molecular Weight 10kDa
Gene ID 414149
NCBI Accession NP_001034933, NM_001039844
UniProt Q8N6N7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ACBD7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Acyl-CoA Binding Domain Containing 7 (ACBD7)", type "Antibodies"
Hosts (7)
Reactivities (6)
Applications (6), (2), (1)
Epitopes (4), (2), (2), (1)
Beacon