Acyl-CoA Binding Domain Containing 7 (ACBD7) (N-Term) antibody

Details for Product No. ABIN503903
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9230116B18Rik, RGD1564164, bA455B2.2, zgc:114176
Epitope
N-Term
(3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(7)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN503903
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ACBD7
Sequence MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGD INIACPGMLD
Predicted Reactivity Human : 100 %, Bovine : 80 %, Horse : 80 %, Guinea pig : 80 %, Rabbit : 80 %, Mouse : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against ACBD7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ACBD7
Background The function of this protein remains unknown.
Molecular Weight 10 kDa
Gene ID 414149
NCBI Accession NM_001039844, NP_001034933
UniProt Q8N6N7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 88 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Acyl-CoA Binding Domain Containing 7 (ACBD7) (N-Term) antibody WB Suggested Anti-ACBD7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10...." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Hosts (8)
Reactivities (7)
Applications (6), (3), (2)
Epitopes (3), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top