WD Repeat Containing Planar Cell Polarity Effector (WDPCP) (N-Term) antibody

Details for Product No. ABIN503909
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bbs15, c2orf86, fritz, frtz, BBS15, C2orf86, FRITZ, FRTZ, RGD1309501, AV249152
Epitope
N-Term
(8), (7), (1)
Reactivity
Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Human
(9), (1)
Host
Rabbit
(10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (8), (6), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503909
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human LOC51057
Sequence LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIP GPINKTTERH
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Rat : 100 %, Horse : 90 %, Bovine : 80 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against LOC51057. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WDPCP
Background The specific function of this protein remains unknown.
Molecular Weight 68 kDa
Gene ID 51057
NCBI Accession NM_015910, NP_056994
UniProt O95876-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 618 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-WD Repeat Containing Planar Cell Polarity Effector (WDPCP) (N-Term) antibody WB Suggested Anti-WDPCP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Validation Images
back to top