Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503909

WD Repeat Containing Planar Cell Polarity Effector (WDPCP) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BBS15, C2orf86, FRITZ, FRTZ, AV249152, RGD1309501, bbs15, c2orf86, fritz, frtz
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503909
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WDPCP antibody: synthetic peptide directed towards the N terminal of human LOC51057
Sequence LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIP GPINKTTERH
Predicted Reactivity Guinea pig : 100%, Human : 100%, Rat : 100%, Horse : 92%, Bovine : 84%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against LOC51057. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WDPCP
Background The specific function of this protein remains unknown.
Molecular Weight 68kDa
Gene ID 51057
NCBI Accession NP_056994, NM_015910
UniProt O95876-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WDPCP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "WD Repeat Containing Planar Cell Polarity Effector (WDPCP)", type "Antibodies"
Hosts (3)
Reactivities (3)
Applications (3), (2), (1), (1)
Epitopes (2), (2), (1)
Beacon