Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503943

Ornithine Decarboxylase Antizyme 2 (OAZ2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AZ2, AZ-2, Oaz2-ps, Sez15, RGD1562933, AZL, oaz2, wu:fa14f04, zgc:63816, DKFZp459P0525
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503943
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OAZ2 antibody: synthetic peptide directed towards the middle region of human OAZ2
Sequence PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDR APLLKTFSFL
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against OAZ2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OAZ2
Background Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. The ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to
Molecular Weight 21kDa
Gene ID 4947
NCBI Accession NP_002528, NM_002537
UniProt O95190
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OAZ2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Ornithine Decarboxylase Antizyme 2 (OAZ2)", type "Antibodies"
Hosts (6)
Reactivities (5), (4)
Applications (6), (3), (2), (1)
Epitopes (4), (2), (2), (1)
Beacon