Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503951

Pim-1 Oncogene (PIM1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PIM, pim-1, Pim-1, pim2, cb1068, fj47b05, wu:fj47b05, PIM1, pim, pim3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503951
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PIM1 antibody: synthetic peptide directed towards the N terminal of human PIM1
Sequence MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQV GPLLGSGGFG
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Guinea pig : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against PIM1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PIM1
Background PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B, resulting in enhanced nuclear export and
Molecular Weight 36kDa
Gene ID 5292
NCBI Accession NP_002639, NM_002648
UniProt P11309-2
Research Area Cancer, Hematopoietic Progenitors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PIM1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wernig, Gonneville, Crowley et al.: "The Jak2V617F oncogene associated with myeloproliferative diseases requires a functional FERM domain for transformation and for expression of the Myc and Pim proto-oncogenes." in: Blood, Vol. 111, Issue 7, pp. 3751-9, 2008 (PubMed).

Alternatives for antigen "Pim-1 Oncogene (PIM1)", type "Antibodies"
Hosts (95), (29), (3)
Reactivities (115), (57), (56), (37), (36), (36), (24), (24), (1)
Applications (72), (66), (46), (30), (15), (12), (10), (6), (4), (1), (1)
Conjugates (9), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (12), (10), (9), (7), (5), (5), (4), (3), (3), (2), (2), (2), (1), (1)
Beacon