Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Pim-1 Oncogene (PIM1) antibody

Antigen

Pim-1 Oncogene (PIM1)

Synonyms PIM, Pim-1, pim2, cb1068, fj47b05, wu:fj47b05, pim1-a, PIM1, pim3, MGC89574, pim-1, PAP-1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503951
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PIM1
Gene ID PIM1
UniProt P11309-2
Immunogen The immunogen for anti-PIM1 antibody: synthetic peptide directed towards the N terminal of human PIM1
Sequence MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQV GPLLGSGGFG
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PIM1 antibody concentration is 1 mg/ml.
Description PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B, resulting in enhanced nuclear export and
Characteristics Antigen Size: 313 amino acids
Molecular Weight 36kDa

Application Details

Application Notes WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer, Hematopoietic Progenitors
Restrictions For Research Use only

Publications

Product Wernig, Gonneville, Crowley et al.: "The Jak2V617F oncogene associated with myeloproliferative diseases requires a functional FERM domain for transformation and for expression of the Myc and Pim proto-oncogenes." in: Blood, Vol. 111, Issue 7, pp. 3751-9, 2008 (PubMed).

Alternatives

Alternatives for antigen "Pim-1 Oncogene (PIM1)", type "Antibodies"
Hosts Rabbit (32), Mouse (8), Goat (2)
Reactivities Human (34), Mouse (Murine) (10), Rat (Rattus) (10), Cow (Bovine) (5), Dog (Canine) (5), Pig (Porcine) (5), Sheep (Ovine) (5)
Applications Western Blotting (WB) (28), ELISA (24), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (14), Immunofluorescence (IF) (11), Immunohistochemistry (IHC) (10), Immunoprecipitation (IP) (4), Immunocytochemistry (ICC) (2)
Conjugates Biotin (3), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), PE,Cy5.5 (1)
Epitopes C-Term (5), pTyr218 (4), AA 24-37 (2), N-Term (2), Internal Region (1), pTyr118 (1)