Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503970

phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAP41, A230054F23Rik, Pap41
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503970
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for Anti-PRPSAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human PRPSAP2
Sequence MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAE RLGVEMGKVQ
Predicted Reactivity Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against PRPSAP2. It was validated on Western Blot. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PRPSAP2
Background The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS.
Molecular Weight 41kDa
Gene ID 5636
NCBI Accession NP_002758, NM_002767
UniProt O60256
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final Anti-PRPSAP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2)", type "Antibodies"
Hosts (11), (3)
Reactivities (13), (3), (2)
Applications (14), (3), (3), (3), (2), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1)
Beacon