phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2) (N-Term) antibody

Details for Product No. ABIN503970
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PAP41, A230054F23Rik, Pap41
Epitope
N-Term
(2), (1), (1), (1), (1)
Reactivity
Human
(13), (3), (3)
Host
Rabbit
(12), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (5), (3), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503970
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for Anti-PRPSAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human PRPSAP2
Sequence MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAE RLGVEMGKVQ
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against PRPSAP2. It was validated on Western Blot.
Purification Affinity Purified
Alternative Name PRPSAP2
Background The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS.
Molecular Weight 41 kDa
Gene ID 5636
NCBI Accession NM_002767, NP_002758
UniProt O60256
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 369 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-phosphoribosyl Pyrophosphate Synthetase-Associated Protein 2 (PRPSAP2) (N-Term) antibody WB Suggested Anti-PRPSAP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:100
Positive Control: HepG2 cell lysate
Product cited in: Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Hosts (12), (2)
Reactivities (13), (3), (3)
Applications (14), (5), (3), (2), (2), (1), (1), (1)
Epitopes (2), (1), (1), (1), (1)
back to top