Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) antibody

Antigen: Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN503981

Additional Information

Alternative name: PSMD3

Gene ID: PSMD3

UniProt: O43242

Immunogen: The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the N terminal of human PSMD3

Sequence: RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQ FRPRTGKAAS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PSMD3 antibody concentration is 1 mg/ml.

Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits a

Characteristics: Antigen Size: 534 amino acids

Molecular Weight: 61kDa

Application Details

Application Notes: WB Suggested Anti-PSMD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PSMD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).