Did you know that you can buy products from over 140 different suppliers from us?

Plastin 3 (PLS3) (Middle Region) antibody

Details for Product No. ABIN504028
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms T-plastin, MGC68681, t-plastin, MGC106020, DKFZp459D0939
Epitope
Middle Region
(2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(30), (16), (15), (12), (12), (12)
Host
Rabbit
(30), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (18), (10), (9), (5), (5), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504028
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PLS3
Sequence RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQ SFKDKTISSS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Guinea pig : 90 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against PLS3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PLS3
Background Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as
Molecular Weight 71 kDa
Gene ID 5358
NCBI Accession NM_005032, NP_005023
UniProt P13797
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 630 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Plastin 3 (PLS3) (Middle Region) antibody WB Suggested Anti-PLS3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate
Background publications Oprea, Kröber, McWhorter et al.: "Plastin 3 is a protective modifier of autosomal recessive spinal muscular atrophy." in: Science (New York, N.Y.), Vol. 320, Issue 5875, pp. 524-7, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504028
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top