Microfibrillar Associated Protein 1 (MFAP1) (Middle Region) antibody

Details for Product No. ABIN504041
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Mfap1, 4432409M24Rik, AMF
Epitope
Middle Region
(5), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(7), (1)
Host
Rabbit
(9)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3)
Pubmed 1 reference available
Catalog no. ABIN504041
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MFAP1
Sequence TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVF ERPSAKKRKT
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against MFAP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MFAP1
Background MFAP1 is a component of the elastin-associated microfibrils.
Molecular Weight 52 kDa
Gene ID 4236
NCBI Accession NM_005926, NP_005917
UniProt P55081
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 439 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Microfibrillar Associated Protein 1 (MFAP1) (Middle Region) antibody WB Suggested Anti-MFAP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Hosts (9)
Reactivities (7), (1)
Applications (8), (3)
Epitopes (5), (2), (1), (1)
back to top