Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504049

serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Spi14, MEPI, PI14, PANCPIN, TSA2004
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504049
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SERPINI2 antibody: synthetic peptide directed towards the middle region of human SERPINI2
Sequence LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEV YVSQVTQKVF
Predicted Reactivity Bovine : 100%, Horse : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 92%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against SERPINI2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SERPINI2
Background The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation, fibrinolysis, developmen
Molecular Weight 46kDa
Gene ID 5276
NCBI Accession NP_006208, NM_006217
UniProt O75830
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SERPINI2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "serpin Peptidase Inhibitor, Clade I (Pancpin), Member 2 (SERPINI2)", type "Antibodies"
Hosts (26), (6), (4), (3)
Reactivities (32), (19), (15), (14)
Applications (26), (15), (10), (7), (3), (2), (1)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (3), (2), (1), (1), (1)
Beacon