Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504072

Phosphoglucomutase 3 (PGM3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AGM1, PAGM, PGM 3, Agm1, Pgm-3, C77933, BB187688, 2810473H05Rik, pgm3, MGC69105, wu:fc08c11, wu:fc39c03, zgc:91932, PGM3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504072
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PGM3 antibody: synthetic peptide directed towards the N terminal of human PGM3
Sequence IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTV LGGQFHDYGL
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Guinea pig : 92%, Horse : 92%, Pig : 90%, Chicken : 78%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against PGM3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PGM3
Background PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.
Molecular Weight 60kDa
Gene ID 5238
NCBI Accession NP_056414, NM_015366
UniProt O95394
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PGM3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Woo, Kim, Jun et al.: "PRR5, a novel component of mTOR complex 2, regulates platelet-derived growth factor receptor beta expression and signaling." in: The Journal of biological chemistry, Vol. 282, Issue 35, pp. 25604-12, 2007 (PubMed).

Alternatives for antigen "Phosphoglucomutase 3 (PGM3)", type "Antibodies"
Hosts (14), (10)
Reactivities (22), (3), (1), (1)
Applications (23), (8), (6), (5), (5), (2), (2), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon