Did you know that you can buy products from over 140 different suppliers from us?

Family with Sequence Similarity 135, Member B (FAM135B) (Middle Region) antibody

Details for Product No. ABIN504081
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C8ORFK32, 1700010C24Rik, A830008O07Rik, RGD1308133, MGC81353
Epitope
Middle Region
(1)
Reactivity
Rat (Rattus), Human
(13), (12), (12)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504081
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FAM135B
Sequence TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQ KTGLQYFKNV
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Mouse : 100 %, Rabbit : 100 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against FAM135B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM135B
Background The function of this protein remains unknown.
Molecular Weight 156 kDa
Gene ID 51059
NCBI Accession NM_015912, NP_056996
UniProt Q49AJ0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1406 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 135, Member B (FAM135B) (Middle Region) antibody WB Suggested Anti-FAM135B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human brain
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504081
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top