Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504081

Family with Sequence Similarity 135, Member B (FAM135B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C8ORFK32, 1700010C24Rik, A830008O07Rik, RGD1308133, MGC81353
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504081
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM135B antibody: synthetic peptide directed towards the middle region of human FAM135B
Sequence TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQ KTGLQYFKNV
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Mouse : 100%, Rabbit : 100%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against FAM135B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM135B
Background The function of this protein remains unknown.
Molecular Weight 156kDa
Gene ID 51059
NCBI Accession NP_056996, NM_015912
UniProt Q49AJ0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM135B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 135, Member B (FAM135B)", type "Antibodies"
Hosts (14)
Reactivities (13), (12), (12)
Applications (10), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon