Did you know that you can buy products from over 140 different suppliers from us?

Mitochondrial Ribosomal Protein L48 (MRPL48) (Middle Region) antibody

Details for Product No. ABIN504093
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC290, L48MT, MRP-L48, 1810030E20Rik, 2610028L11Rik, CGI-118, D4Ertd786e
Epitope
Middle Region
(7), (7), (5), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(21), (6), (5)
Host
Rabbit
(20), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (14), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504093
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MRPL48
Sequence KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYV HNLCNSLSIK
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against MRPL48. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MRPL48
Background Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75 % prot
Molecular Weight 24 kDa
Gene ID 51642
NCBI Accession NM_016034, NP_057139
UniProt Q96GC5
Research Area Signaling, Metabolism, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 212 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitochondrial Ribosomal Protein L48 (MRPL48) (Middle Region) antibody WB Suggested Anti-MRPL48 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504093
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top