Vacuolar Protein Sorting 29 Homolog (S. Cerevisiae) (VPS29) (N-Term) antibody

Details for Product No. ABIN504106
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DC15, PEP11, AW049835, 2010015D08Rik, ATVPS29, MAIGO 1, VACUOLAR PROTEIN SORTING 29, VPS29, fb06g05, wu:fb06g05, zgc:56191, zgc:86638, VPT6, DDBDRAFT_0188107, DDBDRAFT_0234192, DDB_0188107, DDB_023419 ... show more
DC15, PEP11, AW049835, 2010015D08Rik, ATVPS29, MAIGO 1, VACUOLAR PROTEIN SORTING 29, VPS29, fb06g05, wu:fb06g05, zgc:56191, zgc:86638, VPT6, DDBDRAFT_0188107, DDBDRAFT_0234192, DDB_0188107, DDB_0234192, 17.m07782, vps29 show less
Epitope
N-Term
(7), (6), (1), (1)
Reactivity
Mouse (Murine), Human
(13), (5), (5), (4), (1)
Host
Rabbit
(12), (6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (10), (4), (3)
Pubmed 1 reference available
Catalog no. ABIN504106
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human VPS29
Sequence LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKV VTVGQFKIGL
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Zebrafish : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against VPS29. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name VPS29
Background This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome
Molecular Weight 20 kDa
Gene ID 51699
NCBI Accession NM_016226, NP_057310
UniProt Q9UBQ0
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 182 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Vacuolar Protein Sorting 29 Homolog (S. Cerevisiae) (VPS29) (N-Term) antibody WB Suggested Anti-VPS29 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysate
Background publications Hierro, Rojas, Rojas et al.: "Functional architecture of the retromer cargo-recognition complex." in: Nature, Vol. 449, Issue 7165, pp. 1063-7, 2007 (PubMed).

Hosts (12), (6), (1)
Reactivities (13), (5), (5), (4), (1)
Applications (12), (10), (4), (3)
Epitopes (7), (6), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top