Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504106

Vacuolar Protein Sorting 29 Homolog (S. Cerevisiae) (VPS29) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DC15, PEP11, AW049835, 2010015D08Rik, ATVPS29, MAIGO 1, VACUOLAR PROTEIN SORTING 29, VPS29, fb06g05, wu:fb06g05, zgc:56191, zgc:86638, VPT6, DDBDRAFT_0188107, DDBDRAFT_0234192, DDB_0188107, DDB_023419 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504106
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-VPS29 antibody: synthetic peptide directed towards the N terminal of human VPS29
Sequence LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKV VTVGQFKIGL
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Zebrafish : 100%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against VPS29. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name VPS29
Background This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome
Molecular Weight 20kDa
Gene ID 51699
NCBI Accession NP_057310, NM_016226
UniProt Q9UBQ0
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-VPS29 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hierro, Rojas, Rojas et al.: "Functional architecture of the retromer cargo-recognition complex." in: Nature, Vol. 449, Issue 7165, pp. 1063-7, 2007 (PubMed).

Alternatives for antigen "Vacuolar Protein Sorting 29 Homolog (S. Cerevisiae) (VPS29)", type "Antibodies"
Hosts (14), (8), (1)
Reactivities (17), (7), (6), (5), (1)
Applications (15), (13), (6), (3), (1), (1), (1)
Epitopes (7), (5), (1), (1), (1)
Beacon