Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504168

Vacuolar Protein Sorting 37 Homolog C (S. Cerevisiae) (VPS37C) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AU042646, 5730409F24Rik, RGD1309258
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504168
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-VPS37C antibody: synthetic peptide directed towards the N terminal of human VPS37C
Sequence LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQEL RKLVERCQEQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Rat : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against VPS37C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name VPS37C
Background VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies
Molecular Weight 39kDa
Gene ID 55048
NCBI Accession NP_060436, NM_017966
UniProt A5D8V6
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-VPS37°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Eastman, Martin-Serrano, Chung et al.: "Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding." in: The Journal of biological chemistry, Vol. 280, Issue 1, pp. 628-36, 2004 (PubMed).

Alternatives for antigen "Vacuolar Protein Sorting 37 Homolog C (S. Cerevisiae) (VPS37C)", type "Antibodies"
Hosts (8), (8)
Reactivities (14)
Applications (15), (7), (4), (1), (1)
Epitopes (6), (2), (1), (1), (1), (1)
Beacon