Did you know that you can buy products from over 140 different suppliers from us?

Vacuolar Protein Sorting 37 Homolog C (S. Cerevisiae) (VPS37C) (N-Term) antibody

Details for Product No. ABIN504168
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1309258, 5730409F24Rik, AU042646
Epitope
N-Term
(11), (7), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(20)
Host
Rabbit
(14), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (11), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504168
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human VPS37C
Sequence LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQEL RKLVERCQEQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Rat : 100 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against VPS37C. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name VPS37C
Background VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies
Molecular Weight 39 kDa
Gene ID 55048
NCBI Accession NM_017966, NP_060436
UniProt A5D8V6
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 355 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Vacuolar Protein Sorting 37 Homolog C (S. Cerevisiae) (VPS37C) (N-Term) antibody WB Suggested Anti-VPS37C Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle
Background publications Eastman, Martin-Serrano, Chung et al.: "Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding." in: The Journal of biological chemistry, Vol. 280, Issue 1, pp. 628-36, 2004 (PubMed).

Validation Images
back to top