Mitochondrial Ribosomal Protein L47 (MRPL47) antibody

Antigen: Mitochondrial Ribosomal Protein L47 (MRPL47)

Synonyms: BcDNA:AT29239, CG9378, DmelCG9378, MRP-L47, mRpL47, NCM1, CGI-204, MGC45403, L47mt, Gm9859, MTF/L47, 4833424P18Rik, ENSMUSG00000051761, MGC125055, MRPL47, MGC142402

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN504356

Additional Information

Alternative name: MRPL47

Gene ID: MRPL47

UniProt: Q9HD33-3

Immunogen: The immunogen for anti-MRPL47 antibody: synthetic peptide directed towards the middle region of human MRPL47

Sequence: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQW VIPWHLNKRY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MRPL47 antibody concentration is 1 mg/ml.

Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Characteristics: Antigen Size: 140 amino acids

Molecular Weight: 17kDa

Application Details

Application Notes: WB Suggested Anti-MRPL47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MRPL47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Publications

Product: Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).