Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504505

CaM Kinase-Like Vesicle-Associated (CAMKV) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1G5, VACAMKL, BB074618, BC017634, camkv, zgc:63506, CAMKV
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504505
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CAMKV antibody: synthetic peptide directed towards the N terminal of human CAMKV
Sequence NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRF YAISARFKPF
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against CAMKV. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CAMKV
Background CAMKV does not appear to have detectable kinase activity.
Molecular Weight 55kDa
Gene ID 79012
NCBI Accession NP_076951, NM_024046
UniProt Q8NCB2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CAMKV antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).

Alternatives for antigen "CaM Kinase-Like Vesicle-Associated (CAMKV)", type "Antibodies"
Hosts (14), (4)
Reactivities (16), (7), (6)
Applications (17), (8), (3), (3), (3), (2), (1), (1)
Epitopes (5), (3), (2), (2), (1), (1)
Beacon