Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504563

Receptor-Interacting serine-threonine Kinase 3 (RIPK3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RIP3, Hcyp2, 2610528K09Rik, AW107945, Rip3, RIPK3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN504563
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RIPK3 antibody: synthetic peptide directed towards the middle region of human RIPK3
Sequence ETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMV ENNMNAAVST
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against RIPK3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RIPK3
Background RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.
Molecular Weight 57kDa
Gene ID 11035
NCBI Accession NP_006862, NM_006871
UniProt Q9Y572
Research Area Apoptosis/Necrosis, Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RIPK3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cerhan, Ansell, Fredericksen et al.: "Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma." in: Blood, Vol. 110, Issue 13, pp. 4455-63, 2007 (PubMed).

Alternatives for antigen "Receptor-Interacting serine-threonine Kinase 3 (RIPK3)", type "Antibodies"
Hosts (61), (5)
Reactivities (51), (26), (11), (6), (5), (4), (4), (4), (1)
Applications (54), (18), (15), (14), (4), (4), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (5), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon