Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Receptor-Interacting serine-threonine Kinase 3 (RIPK3) antibody

Antigen

Receptor-Interacting serine-threonine Kinase 3 (RIPK3)

Synonyms RIP3, Hcyp2, RIPK3, MGC152488
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN504563
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name RIPK3 / RIP3
Gene ID RIPK3
UniProt Q9Y572
Immunogen The immunogen for anti-RIPK3 antibody: synthetic peptide directed towards the middle region of human RIPK3
Sequence ETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMV ENNMNAAVST
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RIPK3 antibody concentration is 1 mg/ml.
Description RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 518 amino acids
Molecular Weight 57kDa

Application Details

Application Notes WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate.
Immunohistochemistry with Spleen tissue at an antibody concentration of 5µg/ml using anti-RIPK3 antibody (ABIN504563).
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Cerhan, Ansell, Fredericksen et al.: "Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma." in: Blood, Vol. 110, Issue 13, pp. 4455-63, 2007 (PubMed).

Alternatives

Alternatives for antigen "Receptor-Interacting serine-threonine Kinase 3 (RIPK3)", type "Antibodies"
Hosts Rabbit (40), Mouse (3)
Reactivities Human (32), Mouse (Murine) (16), Rat (Rattus) (11), Cow (Bovine) (7), Dog (Canine) (6), Guinea Pig (5), Pig (Porcine) (5)
Applications Western Blotting (WB) (32), ELISA (19), Immunohistochemistry (IHC) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunofluorescence (IF) (5), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), FITC (1), PE,Cy5.5 (1)
Epitopes N-Term (5), C-Term (4), AA 473-486 (2), Center (2), Internal Region (2), AA 480-530 (1), AA 498-518 (1)