Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504585

Cyclin-Dependent Kinase 9 (CDK9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TAK, C-2k, CTK1, CDC2L4, PITALRE, wu:fb22e09, wu:fc06c02, CDK9, CG5179, Dmel\\CG5179, P-TEF, P-TEFb, PTefb, cdk9, c-2k, cdc2l4, ctk1, pitalre, tak
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504585
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDK9 antibody: synthetic peptide directed towards the N terminal of human CDK9
Sequence MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK TGQKVALKKV
Predicted Reactivity Chicken : 100%, Dog : 100%, Human : 100%, African clawed frog : 92%, Bovine : 92%, Mouse : 92%, Pig : 92%, Rat : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against CDK9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CDK9
Background CDK9 is the member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also called positive transcription elongation factor b (P-TEFb), which facilitates the transition from abortive to production elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAP II), SUPT5H and RDBP. The CDK9/cyclin-K complex has also a kinase activity toward CTD of RNAP II and can substitute for P-TEFb in vitro.The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS.
Molecular Weight 43kDa
Gene ID 1025
NCBI Accession NP_001252, NM_001261
UniProt P50750
Research Area Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDK9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sabò, Lusic, Cereseto et al.: "Acetylation of conserved lysines in the catalytic core of cyclin-dependent kinase 9 inhibits kinase activity and regulates transcription." in: Molecular and cellular biology, Vol. 28, Issue 7, pp. 2201-12, 2008 (PubMed).

Alternatives for antigen "Cyclin-Dependent Kinase 9 (CDK9)", type "Antibodies"
Hosts (74), (21)
Reactivities (93), (50), (46), (33), (33), (33), (25), (8), (1), (1)
Applications (70), (50), (26), (25), (20), (16), (5), (3), (3), (3), (3), (2), (2), (1), (1)
Conjugates (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2)
Epitopes (18), (16), (9), (6), (2), (2), (1), (1)
Beacon