Cyclin-Dependent Kinase 9 (CDK9) antibody

Antigen: Cyclin-Dependent Kinase 9 (CDK9)

Synonyms: TAK, C-2k, CTK1, CDC2L4, PITALRE, CDK9, P-TEF, P-TEFb, PTefb, DmelCG5179, CG5179, wu:fb22e09, wu:fc06c02, MGC95175, cdk9, MGC53831, MGC139578, tak, c-2k, cdc2l4, pitalre, MGC69296

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN504585

Additional Information

Alternative name: CDK9

Gene ID: CDK9

UniProt: P50750

Immunogen: The immunogen for anti-CDK9 antibody: synthetic peptide directed towards the N terminal of human CDK9

Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK TGQKVALKKV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CDK9 antibody concentration is 1 mg/ml.

Description: CDK9 is the member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also called positive transcription elongation factor b (P-TEFb), which facilitates the transition from abortive to production elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAP II), SUPT5H and RDBP. The CDK9/cyclin-K complex has also a kinase activity toward CTD of RNAP II and can substitute for P-TEFb in vitro.The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 372 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-CDK9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.
Immunohistochemistry with Uterus tissue at an antibody concentration of 5µg/ml using anti-CDK9 antibody (ABIN504585).

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cell Cycle

Restrictions: For Research Use only

Images

WB Suggested Anti-CDK9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Immunohistochemistry with Uterus tissue at an antibody concentration of 5µg/ml using anti-CDK9 antibody (AVARP03004_P050)

Publications

Product: Sabò, Lusic, Cereseto et al.: "Acetylation of conserved lysines in the catalytic core of cyclin-dependent kinase 9 inhibits kinase activity and regulates transcription." in: Molecular and cellular biology, Vol. 28, Issue 7, pp. 2201-12, 2008 (PubMed).