ADAM2 antibody (N-Term)
-
- Target See all ADAM2 Antibodies
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
-
Binding Specificity
- AA 231-274, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADAM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- WIDENKIATT GEANELLHTF LRWKTSYLVL RPHDVAFLLV YREK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ADAM metallopeptidase domain 2
Protein Name: Disintegrin and metalloproteinase domain-containing protein 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ADAM2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
- Alternative Name
- ADAM2 (ADAM2 Products)
- Synonyms
- AI323749 antibody, Ftnb antibody, Ph30-beta antibody, CRYN1 antibody, CRYN2 antibody, CT15 antibody, FTNB antibody, PH-30b antibody, PH30 antibody, PH30-beta antibody, PH-30 antibody, a disintegrin and metallopeptidase domain 2 antibody, ADAM metallopeptidase domain 2 antibody, Adam2 antibody, ADAM2 antibody
- Background
-
ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.
Synonyms: ADAM2 | CT15 | Fertilin beta | Fertilin subunit beta | Ftnb | PH30 | PH-30 | Ph30 beta | PH30-beta | Q99965 - Gene ID
- 2515
- UniProt
- Q99965
-