PHACS antibody

Catalog No. ABIN629591

Product Details anti-PHACS Antibody

Target: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHACS antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHACS Blocking Peptide, catalog no. 33R-8217, is also available for use as a blocking control in assays to test for specificity of this PHACS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHACS

Target: PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))

Alternative Name: PHACS (ACCS Products)

Synonyms: ACS antibody, PHACS antibody, 2610203E10Rik antibody, Phacs antibody, RGD1309314 antibody, fa10f06 antibody, wu:fa10f06 antibody, zgc:113217 antibody, 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) antibody, 1-aminocyclopropane-1-carboxylate synthase (non-functional) antibody, 1-aminocyclopropane-1-carboxylate synthase homolog antibody, 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) antibody, ACCS antibody, Accs antibody, accs antibody

Background: PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.

Molecular Weight: 42 kDa (MW of target protein)