NUDT12 antibody
-
- Target See all NUDT12 Antibodies
- NUDT12 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUDT12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- NUDT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ
- Top Product
- Discover our top product NUDT12 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUDT12 Blocking Peptide, catalog no. 33R-4782, is also available for use as a blocking control in assays to test for specificity of this NUDT12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT12 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12))
- Alternative Name
- NUDT12 (NUDT12 Products)
- Synonyms
- 0610016O18Rik antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 12 antibody, peroxisomal NADH pyrophosphatase NUDT12 antibody, NADH pyrophosphatase antibody, nudix hydrolase 12 antibody, nudt12 antibody, BCAN_A0038 antibody, BSUIS_A0039 antibody, SJAG_03091 antibody, BMEA_A0038 antibody, PAAG_04340 antibody, MCYG_01870 antibody, MGYG_04196 antibody, NUDT12 antibody, Nudt12 antibody
- Background
- Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.
- Molecular Weight
- 52 kDa (MW of target protein)
-