Adenylate Kinase 2 antibody (N-Term)
-
- Target See all Adenylate Kinase 2 (AK2) Antibodies
- Adenylate Kinase 2 (AK2)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Adenylate Kinase 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AK2 antibody was raised against the N terminal of AK2
- Purification
- Purified
- Immunogen
- AK2 antibody was raised using the N terminal of AK2 corresponding to a region with amino acids MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML
- Top Product
- Discover our top product AK2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AK2 Blocking Peptide, catalog no. 33R-5718, is also available for use as a blocking control in assays to test for specificity of this AK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Adenylate Kinase 2 (AK2)
- Alternative Name
- AK2 (AK2 Products)
- Synonyms
- ADK-2 antibody, BcDNA:SD09634 antibody, CG3140 antibody, Dak2 antibody, Dmel\\CG3140 antibody, anon-Dak2 antibody, adk2 antibody, NV10896 antibody, wu:fb34f05 antibody, wu:fj80e03 antibody, ADK2 antibody, AK 2 antibody, Ak-2 antibody, D4Ertd220e antibody, MXI22.8 antibody, MXI22_8 antibody, Adenylate kinase 2 antibody, adenylate kinase 2 antibody, adenylate kinase antibody, adenylate kinase 2 S homeolog antibody, Adenylate kinase family protein antibody, Adk2 antibody, AK2 antibody, ak2 antibody, LOC100123971 antibody, ak2.S antibody, Ak2 antibody, AT5G50370 antibody
- Background
- Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-