Peroxiredoxin 6 antibody (Middle Region)

Catalog No. ABIN629774

Product Details anti-Peroxiredoxin 6 Antibody

Target: Peroxiredoxin 6 (PRDX6)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRDX6 antibody was raised against the middle region of PRDX6

Purification: Purified

Immunogen: PRDX6 antibody was raised using the middle region of PRDX6 corresponding to a region with amino acids ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRDX6 Blocking Peptide, catalog no. 33R-1499, is also available for use as a blocking control in assays to test for specificity of this PRDX6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peroxiredoxin 6

Target: Peroxiredoxin 6 (PRDX6)

Alternative Name: PRDX6 (PRDX6 Products)

Synonyms: 1-Cys antibody, AOP2 antibody, NSGPx antibody, PRX antibody, aiPLA2 antibody, p29 antibody, 1-cysPrx antibody, 9430088D19Rik antibody, AA690119 antibody, Aop2 antibody, Aop2-rs3 antibody, Brp-12 antibody, CC26 antibody, CP-3 antibody, GPx antibody, Ltw-4 antibody, Ltw4 antibody, Lvtw-4 antibody, NSGP antibody, ORF06 antibody, Prdx5 antibody, Prdx6-rs3 antibody, mKIAA0106 antibody, zgc:73360 antibody, aop2 antibody, prx-6 antibody, prx6 antibody, prdx6 antibody, PHGPX antibody, peroxiredoxin 6 antibody, peroxiredoxin 6 S homeolog antibody, peroxiredoxin 6 L homeolog antibody, PRDX6 antibody, Prdx6 antibody, prdx6 antibody, prdx6.S antibody, prdx6.L antibody

Background: PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell, it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

Molecular Weight: 25 kDa (MW of target protein)