FNTA antibody (C-Term)

Catalog No. ABIN629775

Product Details anti-FNTA Antibody

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FNTA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FNTA antibody was raised against the C terminal of FNTA

Purification: Purified

Immunogen: FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FNTA Blocking Peptide, catalog no. 33R-2083, is also available for use as a blocking control in assays to test for specificity of this FNTA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FNTA

Target: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Alternative Name: FNTA (FNTA Products)

Synonyms: ATFTA antibody, FARNESYLTRANSFERASE A antibody, FARNESYLTRANSFERASE SUBUNIT A antibody, PFT/PGGT-IALPHA antibody, PLP antibody, PLURIPETALA antibody, farnesyltransferase A antibody, FPTA antibody, PGGT1A antibody, PTAR2 antibody, PFAS antibody, FTA antibody, farnesyltransferase A antibody, farnesyltransferase, CAAX box, alpha antibody, FTA antibody, FNTA antibody, Fnta antibody

Background: Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling