RRP9 antibody (Middle Region)
-
- Target See all RRP9 Antibodies
- RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RRP9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RRP9 antibody was raised against the middle region of RRP9
- Purification
- Purified
- Immunogen
- RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH
- Top Product
- Discover our top product RRP9 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RRP9 Blocking Peptide, catalog no. 33R-4097, is also available for use as a blocking control in assays to test for specificity of this RRP9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RRP9 (Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (RRP9))
- Alternative Name
- RRP9 (RRP9 Products)
- Synonyms
- Rnu3ip2 antibody, RNU3IP2 antibody, U3-55K antibody, 55kDa antibody, D19435 antibody, D9Wsu10e antibody, U3-55k antibody, ribosomal RNA processing 9, U3 small nucleolar RNA binding protein antibody, RRP9, small subunit (SSU) processome component, homolog (yeast) antibody, Rrp9 antibody, RRP9 antibody
- Background
- RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection
-