HNRNPA0 antibody (Middle Region)
-
- Target See all HNRNPA0 Antibodies
- HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRNPA0 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HNRPA0 antibody was raised against the middle region of HNRPA0
- Purification
- Purified
- Immunogen
- HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
- Top Product
- Discover our top product HNRNPA0 Primary Antibody
-
-
- Application Notes
-
WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPA0 Blocking Peptide, catalog no. 33R-4234, is also available for use as a blocking control in assays to test for specificity of this HNRPA0 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))
- Alternative Name
- HNRPA0 (HNRNPA0 Products)
- Synonyms
- HNRPA0 antibody, 1110055B05Rik antibody, 3010025E17Rik antibody, Hnrpa0 antibody, hnRNP A0 antibody, fc01g05 antibody, wu:fc01g05 antibody, zgc:77366 antibody, fi36h08 antibody, hnrnpa0 antibody, hnrpa0 antibody, wu:fa16d06 antibody, wu:fi36h08 antibody, zgc:77280 antibody, MGC53160 antibody, MGC130809 antibody, RGD1563684 antibody, HNRNPA0 antibody, heterogeneous nuclear ribonucleoprotein A0 antibody, heterogeneous nuclear ribonucleoprotein A0a antibody, heterogeneous nuclear ribonucleoprotein A0b antibody, heterogeneous nuclear ribonucleoprotein A0 L homeolog antibody, Heterogeneous nuclear ribonucleoprotein A0 antibody, HNRNPA0 antibody, Hnrnpa0 antibody, hnrnpa0a antibody, hnrnpa0b antibody, hnrpa0 antibody, hnrnpa0 antibody, hnrnpa0.L antibody, roa0 antibody
- Background
- HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.
- Molecular Weight
- 34 kDa (MW of target protein)
-